Wikidata:Database reports/Constraint violations/P5019
Jump to navigation
Jump to search
Constraint violations report for Brockhaus Enzyklopädie online ID (Discussion, uses, items, changes, related properties): identifier for an article in the online version of Brockhaus Enzyklopädie
Data time stamp: (UTC) — Items processed: 37,962
The report is generated based on the settings on Property:P5019#P2302.
Updates overwrite this page. Some may already be fixed since the last update: check RecentChangesLinked.
When incremental dumps and the bot work as planned, items fixed before 07:00 UTC disappear in the next update. The report is not updated if only the item count changes.
The report can include false positives. There is no need to "fix" them.
Data time stamp: (UTC) — Items processed: 37,962
The report is generated based on the settings on Property:P5019#P2302.
Updates overwrite this page. Some may already be fixed since the last update: check RecentChangesLinked.
When incremental dumps and the bot work as planned, items fixed before 07:00 UTC disappear in the next update. The report is not updated if only the item count changes.
The report can include false positives. There is no need to "fix" them.
"Single value" violations[edit]
Violations count: 262
- Belarus (Q184): Belarus, belorus
- Gdynia (Q385): gdynia, gdingen
- Latin (Q397): lateinische-sprache, latein
- cuneiform (Q401): keilschrift, schreibgriffel
- North Korea (Q423): korea-20, nordkorea
- Milan (Q490): mailand, milano
- Lisbon (Q597): lissabon-20, lisboa-20
- iron (Q677): Hola, eisen-20
- Suriname (Q730): suriname, suriname-20
- Samara (Q894): samara, kuibyschew
- Omsk (Q898): omsk, omsk-20
- Volgograd (Q914): wolgograd-20, wolgograd
- Perm (Q915): perm, molotow-20
- Sudan (Q1049): sudan-20, sudan
- Eswatini (Q1050): Eswatini, swasiland
- immune system (Q1059): immunsystem, immunabwehr
- Prague (Q1085): praha, prag
- Ghent (Q1296): gent, gand
- Caligula (Q1409): caligula-20, caligula-gaius
- Buenos Aires (Q1486): buenos-aires, buenos-aires-20
- Stockholm (Q1754): stockholm, stockholm-20
- Gdańsk (Q1792): danzig-40, gdansk
- Kinshasa (Q3838): leopoldville, kinshasa
- Goslar (Q3896): goslar-30, goslar-20
- Union of South American Nations (Q4230): sudamerikanische-staatengemeinschaft, comunidad-sudamericana-de-naciones, union-sudamerikanischer-nationen, comunidade-sul-americana-de-nacoes, unasur
- Amarna (Q5736): tell-el-amarna, amarna
- Mark Twain (Q7245): twain-mark, mark-twain
- Irène Joliot-Curie (Q7504): joliot-curie-irene, curie-irene
- International Monetary Fund (Q7804): international-monetary-fund, imf
- World Health Organization (Q7817): who, world-health-organization, weltgesundheitsorganisation
- protein (Q8054): proteine, eiweiss-biochemie
- Ostrava (Q8385): ostrau, ostrava
- Chanakya (Q9045): canakya, kautilya
- peritoneum (Q9629): peritoneum, bauchfell
- Noord-Beveland (Q10077): noord-beveland, nordbeveland
- carbohydrate (Q11358): kohlenhydrate, saccharide
- Schaerbeek (Q12887): schaerbeek, schaarbeek
- NBC (Q13974): nbc, national-broadcasting-company
- Paul VI (Q16975): paul-paul-vi, paul-vi-papst
- Mount Etna (Q16990): ätna, ätna-welterbe
- aspirin (Q18216): acetylsalicylsäure, ass-20, aspirinr
- chymosin (Q25902): chymosin, rennin
- collagen (Q26868): collagen, kollagen
- Levisticum officinale (Q27615): liebstöckel, maggikraut
- nucleolus (Q30869): nukleolus, kernkörperchen-zytologie
- Lysychansk (Q33280): lyssytschansk, lisicansk
- English Channel (Q34640): ärmelkanal, english-channel
- Bauchi (Q34974): bauchi, bauchi-20
- Sea of Marmara (Q35367): marmarameer, marmarasee
- Almaty (Q35493): almaty, alma-ata
- Society of Jesus (Q36380): jesuiten, societas-jesu, gesellschaft-jesu
- Sint-Truiden (Q37792): saint-trond, sint-truiden
- Caesarion (Q39589): kaisarion, ptolemaios-ptolemaios-xv-kaisar
- syphilis (Q41083): syphilis, lues
- Sully Prudhomme (Q42247): sully-prudhomme, prudhomme-rene-francois-armand
- Phaseolus vulgaris (Q42339): fisole-österreichisch, wachsbohne, stangenbohne, buschbohne
- Warren Buffett (Q47213): buffett-warren-edwards, buffett-warren-edward
- Amerigo Vespucci (Q47674): vespucci-amerigo, amerigo-vespucci
- Nijmegen (Q47887): nimwegen, nijmegen
- Mariehamn (Q48329): mariehamn, maarianhamina
- ZDF (Q48989): zdf, zweites-deutsches-fernsehen
- Lope de Rueda (Q52206): lope-de-rueda, rueda-lope-de
- Jesse Owens (Q52651): lecvc, owens-jesse
- Stephen Báthory (Q54030): stephan-stephan-iv-bathory, stephan-stephan-bathory
- Wong Kar-wai (Q55431): wong-kar-wai, kar-wai-wong
- Angelus Silesius (Q60469): angelus-silesius, silesius
- Henry Raspe, Landgrave of Thuringia (Q61367): heinrich-heinrich-raspe-iv, raspe-iv
- Ludwig Renn (Q61585): vieth-von-golssenau, renn-ludwig
- Koszalin (Q62868): köslin-20, koszalin
- Elia Levita (Q66031): levita-elia, elia-levita
- Anabasis (Q73112): anabasis, anabasis-20
- Meister Eckhart (Q76548): eckhart, meister-eckhart
- plant sap (Q76626): milchsaft-physiologie, milchsaft-botanik
- Stephan Hermlin (Q77744): hermlin-stephan, leder-20
- Count Anton Alexander von Auersperg (Q79069): grun-anastasius, auersperg-anton-alexander
- Lake Assal (Q81239): lac-assal, assalsee
- Giza (Q81788): giza, gisa
- chopsticks (Q81980): essstäbchen, chopsticks
- Gaia (Q93172): gäa-griechische-mythologie, ge-griechische-mythologie
- Paul IV (Q101430): paul-paul-iv, carafa-gian-pietro-auch-giampietro
- Calliope (Q103975): calliope-griechische-mythologie, kalliope
- Chorzów (Q104302): chorzow, königshutte
- blood serum (Q110084): serum, blutserum
- Christoph Graupner (Q115067): graupner-christoph, graupner-johann-christoph
- Hazaras (Q115473): hazara, hasara
- Heracles (Q122248): herakles-griechische-mythologie, alkide
- Lisa Della Casa (Q123575): della-casa-lisa, casa-lisa-della
- Oedipus (Q130890): oidipus-griechische-mythologie, ödipus-griechische-mythologie
- Crataegus (Q132557): weissdorn, crataegus
- Tao Te Ching (Q134425): daodejing, tao-te-ching
- carboxylic acid (Q134856): carbonsäuren, karbonsäuren
- peroxisome (Q138639): peroxisomen, microbodies
- sterol (Q143623): sterine, sterole
- silicone (Q146439): silicone, silikone
- cytoskeleton (Q154626): zellskelett, zytoskelett
- Kamyanske (Q156719): dnjeprodserschinsk, kamenskoje
- citric acid (Q159683): citronensäure, zitronensäure
- Heraklion (Q160544): heraklion, iraklion
- Sievierodonetsk (Q160584): sjewjerodonezk, severodoneck
- Piper methysticum (Q161067): kawapfeffer, rauschpfeffer
- eucalyptol (Q161572): eucalyptol, cineol
- sudden infant death syndrome (Q161801): plötzlicher-kindstod-20, plötzlicher-kindstod
- mesosphere (Q162167): mesosphäre-meteorologie, mesosphäre-geologie
- Quercus robur (Q165145): sommereiche, stieleiche
- World Meteorological Organization (Q170424): world-meteorological-organization, wmo, meteorologische-weltorganisation, weltorganisation-fur-meteorologie
- scoliosis (Q174857): skoliose, wirbelsäulenverkrummung
- mumps (Q176741): mumps, ziegenpeter
- World Intellectual Property Organization (Q177773): wipo-20, weltorganisation-fur-geistiges-eigentum
- cilium (Q180436): zilien, cilien
- Hrodna (Q181376): hrodna, grodno
- Jihlava (Q183111): iglau, jihlava
- Szklarska Poręba (Q186495): schreiberhau, szklarska-poreba
- cycloalkane (Q188862): cycloalkane, cycloparaffine
- messenger RNA (Q188928): mrna, messenger-rna
- Brian De Palma (Q189526): palma-brian, de-palma-brian
- carotene (Q190156): carotin, karotin
- Harar (Q190184): harrar, harar
- vitalism (Q191631): vitalismus, neovitalismus
- Organisation of African Unity (Q191703): organization-of-african-unity, organisation-fur-afrikanische-einheit, oau
- niacinamide (Q192423): nikotinsäureamid, niacinamid
- diene (Q192678): diene, diolefine
- Roger Penrose (Q193803): penrose-roger, roger-penrose
- casein (Q193970): milcheiweiss, casein, kasein
- Guillaume de Machaut (Q200580): guillaume-de-machaut, machaut-guillaume
- human follitropin (Q200774): follikelstimulierendes-hormon, follitropin-biochemie
- Uccle - Ukkel (Q203312): ukkel, uccle
- floorball (Q206763): floorball, unihockey
- peptidoglycan (Q206920): peptidoglykan, murein
- Babruysk (Q207294): bobruisk, babruisk
- Shining Path (Q207854): sendero-luminoso, leuchtender-pfad
- Tadao Ando (Q208220): ando-tadao, tadao-ando
- corticosteroid (Q210420): corticosteroide, nebennierenrindenhormone
- Woluwe-Saint-Lambert - Sint-Lambrechts-Woluwe (Q211764): sint-lambrechts-woluwe, woluwe-saint-lambert
- ribosomal RNA (Q215980): rrna, ribosomale-rna
- thyroxine (Q216852): thyroxin, tetrajodthyronin
- Iskar (Q217805): isker, iskar
- thiol (Q220410): mercaptane-chemie, thiole
- butylated hydroxytoluene (Q221945): butylhydroxytoluol, bht
- Aeëtes (Q241971): aeetes-griechische-mythologie, aietes-griechische-mythologie
- Menilek II (Q244748): menelik-ii, menilek-ii
- equipotential surface (Q256040): potenzialfläche, äquipotenzialfläche
- White Anglo-Saxon Protestant (Q256898): wasp, white-anglo-saxon-protestant
- Lugoj (Q258981): lugosch, lugoj
- Bob Hawke (Q269372): Robert-Hawke-bob-lee-James, hawke-robert-bob-james-lee
- Třebíč (Q270704): trebic, trebic-welterbe
- Liptovský Mikuláš (Q272040): liptovsky-mikulas, liptau-sankt-nikolaus
- saline solution (Q275792): kochsalzlösung, physiologische-kochsalzlösung
- Societas Europaea (Q279014): europäische-aktiengesellschaft, societas-europaea
- Étienne de Silhouette (Q290240): silhouette-bildende-kunst, silhouette-allgemein
- Jeff Koons (Q297525): koons-jeff-jeffrey, jeff-koons
- levodopa (Q300989): levodopa, l-dopa-biochemie
- Jean Giraud (Q309240): giraud-jean, moebius
- Ludolph van Ceulen (Q310771): ceulen-ludolf, ludolf-van-ceulen
- anisole (Q312244): anisol, methylphenylether
- German Labor Front (Q312526): daf, deutsche-arbeitsfront
- Curzio Malaparte (Q312637): malaparte-curzio, suckert
- Calcitonin (Q315860): calcitonin, thyreocalcitonin
- Abdullah Ibrahim (Q317677): brand-dollar, ibrahim-abdullah
- Jerzy Kosiński (Q319447): kosinski-jerzy-nikodem, novak-joseph
- aspirated consonant (Q320433): aspiration-phonetik, behauchung-phonetik
- Tullamore (Q321091): tullamore, tulach-mhor
- Le Cateau-Cambrésis (Q329103): le-cateau-cambresis, cateau-cambresis
- Giambattista della Porta (Q334154): della-porta-giovanni-battista-giambattista, porta-giovanni-battista-della
- castor oil (Q337492): rizinusöl, kastoröl
- Feofan Prokopovich (Q348899): prokopowitsch-feofan, feofan-30
- adiaphora (Q356932): adiaphora-philosophie, adiaphora-theologie
- Maximilian Voloshin (Q358885): woloschin-maximilian-alexandrowitsch, kirijenko-woloschin
- Publilius Syrus (Q363375): syrus, publilius-syrus
- John of Montecorvino (Q372219): johannes-von-montecorvino, montecorvino-johannes
- artificial pacemaker (Q372713): herzschrittmacher, herzschrittmacher-20
- Howard Fast (Q380202): fast-howard-melvin, cunningham-e-v
- European Monetary System (Q385239): europäisches-währungssystem, european-monetary-system
- Mazyr (Q386487): masyr, mazyr, mozyr-
- agricultural chemistry (Q397334): agrarchemie, agrochemie, agrikulturchemie
- icosanoid (Q407680): eikosanoide, eicosanoide
- glyceride (Q407758): glyceride, glyzeride
- imine (Q408057): imine, azomethine
- butylated hydroxyanisole (Q409401): butylhydroxyanisol, bha
- raffinose (Q410005): melitose, raffinose
- quinone (Q412382): chinone, chinoides-system
- noscapine (Q415619): noscapin, narkotin
- carminic acid (Q416860): carminsäure, karminsäure
- peptide hormone (Q416997): peptidhormone, proteohormone
- xanthate (Q417615): xanthate-chemie, xanthogenate
- (E)-coniferyl alcohol (Q418993): coniferylalkohol, koniferylalkohol
- alginic acid (Q422092): alginate, alginsäure
- ribonuclease (Q422523): ribonukleasen, rnasen
- caproic acid (Q422597): capronsäure, hexansäure
- Michael Choniates (Q443671): choniates-michael, michael-choniates
- Kenzō Takada (Q454927): takada-kenzo, kenzo-takada
- qanat (Q459297): foggara, qanat
- Spišská Nová Ves (Q462840): spisska-nova-ves, zipser-neudorf
- Les vêpres siciliennes (Q471645): die-sizilianische-vesper, les-vepres-siciliennes
- Andean Community (Q471690): andenpakt, andengemeinschaft
- hemolysis (Q471706): hämolytisch, hämolyse
- Onesimos (Q475054): onesimos, panaitiosmaler
- Tesla, Inc. (Q478214): tesla-motors-inc, tesla-inc
- Hwaeomsa (Q491233): hwaom-sa, hwaeomsa
- Pemba (Q498048): porto-amelia, pemba, pemba-20
- Wodzisław Śląski (Q500260): loslau, wodzislaw-slaski
- Humenné (Q502264): humenne, homenau
- Antonio García Gutiérrez (Q602137): garcia-gutierrez-antonio, gutierrez-antonio-garcia
- Latin American and the Caribbean Economic System (Q605595): sela, sistema-economico-latinoamericano, lateinamerikanisches-wirtschaftssystem
- Latin American Integration Association (Q607301): asociacion-latinoamericana-de-integracion, aladi, lateinamerikanische-integrationsvereinigung
- glycine (Q620730): glyzin, aminoessigsäure, glycin, glykokoll
- Licinia gens (Q636900): licinius-30, licinius-40, licinius-20
- Office of the High Commissioner for Human Rights (Q656812): hoher-kommissar-der-vereinten-nationen-fur-menschenrechte, unhchr
- Swiss Stock Exchange (Q661834): schweizer-börse, six-swiss-exchange-ag
- Arlon (Q675960): arlon, aarlen
- Francis of Assisi (Q676555): franziskus, franz-von-assisi
- Arnica (Q693908): arnika, wohlverleih
- Tadeusz Boy-Żeleński (Q699597): zelenski-tadeusz, boy-zelenski
- Andrzej Frycz Modrzewski (Q728305): modrzewski-frycz-andrzej, frycz-modrzewski
- Sebeș (Q732376): muhlbach, szaszsebes
- Lysistrata (Q753907): lysistrate, lysistrata
- Clotho (Q829669): clotho, klotho-griechische-mythologie
- clitoris (Q873072): clitoris-anatomie, klitoris
- circular dichroism (Q899102): circulardichroismus, zirkulardichroismus-optik
- kaolin (Q908663): porzellanerde, kaolin
- jazz rock (Q944465): fusion-music, fusion-musik, rockjazz
- Jeseník (Q954611): jesenik, fryvaldov
- Johannes de Muris (Q983400): muris, johannes-de-muris
- Sunny Beach (Q1011039): slantschew-brjag, sonnenstrand
- yellow card (Q1048067): verwarnung-sport, gelbe-karte-sport
- Simeon II of Bulgaria (Q1060355): simeon-simeon-ii, sakskoburggotski-simeon
- tempo rubato (Q1063336): tempo-rubato, rubato-musik
- Charles de Gontaut, duc de Biron (Q1066570): biron, charles-de-gontaut
- vasoconstriction (Q1067506): gefässverengung, vasokonstriktion
- telephone card (Q1122035): telefonkarte, kartentelefon
- Church of the Nazarene (Q1189165): church-of-the-nazarene, kirche-des-nazareners
- Anabasis of Alexander (Q1236228): anabasis, anabasis-20
- evidence (Q1347572): evidenz-bildungssprachlich, evidenz-philosophie
- Xia Gui (Q1360244): xia-gui, hsia-kuei
- Ralph Hale Mottram (Q1367624): mottram-ralph-hale, marjoram
- Jan Boudolf (Q1370613): bondol-jan, hennequin-de-bruges
- Camara Laye (Q1371169): laye-camara, camara-laye
- Neroccio di Bartolomeo de' Landi (Q1398270): landi-neroccio-di-bartolomeo-di-benedetto-de-, neroccio
- Prime Standard (Q1425632): prime-standard, prime-all-share-index
- daina (Q1427690): daina-20, daina
- Supreme Headquarters Allied Powers Europe (Q1432908): shape, allied-command-operations
- secant (Q1467935): sekans, secans
- cheese analogue (Q1568226): analogkäse, käseimitat
- Guizotia abyssinica (Q1818500): gingellikraut, nigersaat
- contraindication (Q1848900): gegenanzeige-medizin, kontraindikation
- Luciano Folgore (Q1873306): folgore-luciano, vecchi-omero
- semi-trailer truck (Q1936841): sattelkraftfahrzeug, sattelzug
- Paget's disease of bone (Q2035074): paget-krankheit-20, paget-krankheit
- Haly Abenragel (Q2081331): abenragel, albohazen
- sound archive (Q2230431): schallarchiv, lautarchiv
- axiological neutrality (Q2563485): wertfreiheit-allgemein, wertfreiheit-wissenschaftstheorie
- Bacchant (Q2878203): bacchanten-20, bacchanten
- bathometer (Q3088776): bathymeter, bathometer
- bar (Q3240892): bar-musik, takt-musik
- Laura Riding (Q3312332): riding-laura, jackson-laura-riding
- Erik Sjöberg (Q3436472): vitalis-20, sjöberg-erik
- coordination chemistry (Q3674740): komplex-chemie-20, komplexchemie
- Bouqras (Q4950065): tell-buqras, buqras
- cardoon (Q7223635): spanische-artischocke, cardy
- energeia (Q8775869): energeia-philosophie, energeia-sprachwissenschaft
- meiosis (Q16424695): meiose-biologie, reifeteilung
- aromatic compound (Q19834818): aromatische-verbindungen, aromaten
- Persian knot (Q25041944): persischer-knoten, senneh-knoten
"Unique value" violations[edit]
Violations count: 24
- anabasis: Anabasis (Q73112), Anabasis of Alexander (Q1236228)
- anabasis-20: Anabasis (Q73112), Anabasis of Alexander (Q1236228)
- badge-heraldik: breast badge (Q799000), heraldic badge (Q1429148)
- buenos-aires: Buenos Aires (Q1486), Lake General Carrera/Buenos Aires (Q503842)
- chemolithotroph: chemotroph (Q747472), chemolithotroph (Q10356282)
- europeana: Europeana (Q234110), Europeana Foundation (Q111994853)
- grönland: Greenland (Q223), Greenland (Q4148644)
- historienbibel: Bible Historiale (Q1620808), History Bible (Q87757359)
- innerer-punkt: interior (Q862761), interior point (Q5116525)
- kinder-und-jugendliteratur: children's literature (Q131539), young adult literature (Q1233720)
- komplex-chemie-20: coordination complex (Q238156), coordination chemistry (Q3674740)
- lysozym: Lysozyme (Q21114915), lysozyme family (Q24779410)
- marx-brothers: Marx Brothers (Q64450), Groucho Marx (Q103846)
- milutinovic-sima: Sima Milutinović Sarajlija (Q928385), Sima Milutinović (Q7517311)
- nara: Nara Prefecture (Q131287), Nara (Q169134)
- ozeanien: Insular Oceania (Q538), Oceania (Q55643)
- pearl-harbor: Attack on Pearl Harbor (Q52418), Pearl Harbor (Q127091)
- saccharide: carbohydrate (Q11358), Saccharide (Q10659931)
- schauerroman: Gothic novel (Q192782), horror novel (Q20667180)
- sinigrin: sinigrin potassium (Q423248), sinigrin (Q65772506)
- sportfest: sports festival (Q2312427), sports competition (Q13406554)
- spotify-ab: Spotify (Q689141), Spotify (Q87067874)
- theremin: theremin (Q207691), Leon Theremin (Q333265)
- wakayama: Wakayama Prefecture (Q131314), Wakayama (Q200747)
"Format" violations[edit]
Violations count: 1
"Entity types" violations[edit]
Violations count: 0
"Scope" violations[edit]
Violations count: 0